| Basic Information | |
|---|---|
| Taxon OID | 3300028158 Open in IMG/M |
| Scaffold ID | Ga0256792_1080855 Open in IMG/M |
| Source Dataset Name | Metatranscriptome of enriched soil aggregate microbial communities from Iowa State University, Ames, United States - MC6-MC0943-MT (Metagenome Metatranscriptome) |
| Source Dataset Category | Metatranscriptome |
| Source Dataset Use Policy | Open |
| Sequencing Center | DOE Joint Genome Institute (JGI) |
| Sequencing Status | Permanent Draft |
| Scaffold Components | |
|---|---|
| Scaffold Length (bps) | 514 |
| Total Scaffold Genes | 1 (view) |
| Total Scaffold Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
| Novel Protein Genes | 1 (view) |
| Novel Protein Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
| Associated Families | 1 |
| Taxonomy | |
|---|---|
| Not Available | (Source: ) |
| Source Dataset Ecosystem |
|---|
| Environmental → Terrestrial → Soil → Unclassified → Unclassified → Enriched Soil Aggregate → Enriched Soil Aggregate Microbial Communities From Iowa State University To Study Microbial Drivers Of Carbon Cycling |
| Source Dataset Sampling Location | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location Name | USA: Iowa | |||||||
| Coordinates | Lat. (o) | 42.0 | Long. (o) | -93.0 | Alt. (m) | Depth (m) | Location on Map | |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F021039 | Metagenome / Metatranscriptome | 220 | Y |
| Protein ID | Family | RBS | Sequence |
|---|---|---|---|
| Ga0256792_10808551 | F021039 | N/A | GAIEFVTTNKGRKVLAYGSANANAEEGKQAEPLPPGETKTFDFLKSEGENFPGYVVGFFGQYDENHITYLGVYVAPLTEVNYYARRAYILTYKKLQQDKNLINDIAKKLGVEKEGERFKDANLEDADNNSSRIFLYFLDASLNHPELFKAVLEYL |
| ⦗Top⦘ |