Basic Information | |
---|---|
Taxon OID | 3300028156 Open in IMG/M |
Scaffold ID | Ga0268281_1145655 Open in IMG/M |
Source Dataset Name | Saline water microbial communities from Sakinaw Lake, British Columbia, Canada - sak_2011_5_24_50m |
Source Dataset Category | Metagenome |
Source Dataset Use Policy | Open |
Sequencing Center | DOE Joint Genome Institute (JGI) |
Sequencing Status | Permanent Draft |
Scaffold Components | |
---|---|
Scaffold Length (bps) | 519 |
Total Scaffold Genes | 1 (view) |
Total Scaffold Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
Novel Protein Genes | 1 (view) |
Novel Protein Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
Associated Families | 1 |
Taxonomy | |
---|---|
Not Available | (Source: ) |
Source Dataset Ecosystem |
---|
Environmental → Aquatic → Non-Marine Saline And Alkaline → Saline → Unclassified → Saline Water → Marine Microbial Communities From The Southern Atlantic Ocean Transect To Study Dissolved Organic Matter And Carbon Cycling |
Source Dataset Sampling Location | ||||||||
---|---|---|---|---|---|---|---|---|
Location Name | Canada: Sakinaw lake, British Columbia | |||||||
Coordinates | Lat. (o) | 49.68 | Long. (o) | -124.009 | Alt. (m) | Depth (m) | 50 | Location on Map |
Zoom: | Powered by OpenStreetMap © |
Family | Category | Number of Sequences | 3D Structure? |
---|---|---|---|
F050936 | Metagenome / Metatranscriptome | 144 | Y |
Protein ID | Family | RBS | Sequence |
---|---|---|---|
Ga0268281_11456551 | F050936 | N/A | MELSNDEVGFLNENIVLKDYFYDLLLNIKNSNETKIILCKNSYERRFVHILAISLGLYHSRYGDWSDWFKKYRDYQETVDKIDGQDHYKIVGVKVSTKPLLLSRKDKIHQECK |
⦗Top⦘ |