Scaffold Ga0268349_1031376

Overview

Basic Information

• Taxon OID: 3300028155
• Scaffold ID: Ga0268349_1031376
• Source Dataset Name: Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R2_MAIN_18SEP2017_LD1
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: DOE Joint Genome Institute (JGI)
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 705
• Total Scaffold Genes: 2
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta (Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem: Host-Associated → Plants → Phyllosphere → Unclassified → Unclassified → Phyllosphere → Phyllosphere Microbial Comminities From Bioenergy Crops Switchgrass And Miscanthus From Michigan, Usa

Source Dataset Sampling Location

• Location Name: USA: Michigan
• Coordinates
  • Lat. (^o): 42.39
  • Long. (^o): -85.37

Associated Families

Family	Category	Number of Sequences	3D Structure?
F061597	Metagenome / Metatranscriptome	131	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0268349_10313761	F061597	N/A	FFFLVLWTVGKGRTLDKLTDQPGNLIPLDRAGVPDLSVSRDKFDLAEDDPHDPTTTSEPEAPMQSLNQLPVVTDLVDARSA