NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0256412_1025166

Scaffold Ga0256412_1025166


Overview

Basic Information
Taxon OID3300028137 Open in IMG/M
Scaffold IDGa0256412_1025166 Open in IMG/M
Source Dataset NameMetatranscriptome of seawater microbial communities from Monterey Bay, California, United States - WCR_74 (Metagenome Metatranscriptome)
Source Dataset CategoryMetatranscriptome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)1922
Total Scaffold Genes4 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)3 (75.00%)
Novel Protein Genes3 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)2 (66.67%)
Associated Families3

Taxonomy
All Organisms → Viruses → unclassified viruses → Circular genetic element sp.(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Marine → Coastal → Unclassified → Seawater → Seawater Microbial Communities From Monterey Bay, California, United States

Source Dataset Sampling Location
Location NameUSA: California
CoordinatesLat. (o)36.8313Long. (o)-121.9047Alt. (m)Depth (m)5
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F001611Metagenome / Metatranscriptome663N
F007722Metagenome / Metatranscriptome346Y
F013311Metagenome / Metatranscriptome272Y

Sequences

Protein IDFamilyRBSSequence
Ga0256412_10251661F007722N/AKGLEWDTVATLTGDIGTIKKSIQTLNNRINGLNSPKLNDELLQYAMKQQTNVTDINKKILGG
Ga0256412_10251662F013311AGGAGGLAFLGDFGKFFGLGSSEQVLGDVGSAVGGFIGQGPKGAIIGQQLGKAVGRATSNLGGSDISPASTADQALEQSAVPVSNIGDTGPAETSNVGLTGMQTQQAGFGALPSIIGAARSVFPQIGKFVGTPSGAIATGVGTSLGVNALTGTDMSRMKPVLTQSRRNKARVRQLVNFMGIEGAASFLSQASGQNITGNDVVQLLLRTFRNDGAFITKAQVRNLRRTTNRFKSLEKQVKEATSMTRTTRRPAMRRASSTTLIKN
Ga0256412_10251663F001611AGGAGGMPLVQKTLTLAAGATSDNILANTNYEFVDGNVRLRVASAVDTAGTSATADTFLNVSVNNAEYSKDVSVPALVSGQPFGVLNGSYINNDLLTTGSQRNRVLVRFTNDTAATRTIRCGVFIG
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.