Scaffold Ga0256368_1065176

Overview

Basic Information

• Taxon OID: 3300028125
• Scaffold ID: Ga0256368_1065176
• Source Dataset Name: Sea-ice brine viral communities from Beaufort Sea near Barrow, Alaska, United States - SB
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: DOE Joint Genome Institute (JGI)
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 629
• Total Scaffold Genes: 2
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Associated Families: 1

Taxonomy: All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage (Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Aquatic → Marine → Coastal → Unclassified → Sea-Ice Brine → Extreme Environments Viral Communities From Various Locations

Source Dataset Sampling Location

• Location Name: USA: Alaska
• Coordinates
  • Lat. (^o): 71.3731
  • Long. (^o): -156.5049
  • Depth (m): 0

Associated Families

Family	Category	Number of Sequences	3D Structure?
F026605	Metagenome / Metatranscriptome	197	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0256368_10651762	F026605	N/A	AAFFMARETWEKHGVTQCTHYSESRRREQQRLIENICEKHNIAWEDLPEWPTFAAAYKEFSKIKEQAHADYILTTPNTYGVDSLDVVVEAKAKEKALQNINVECCQTPLILD