Scaffold Ga0228621_1057254

Overview

Basic Information

• Taxon OID: 3300028124
• Scaffold ID: Ga0228621_1057254
• Source Dataset Name: Seawater microbial communities from Monterey Bay, California, United States - 25D
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: DOE Joint Genome Institute (JGI)
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 575
• Total Scaffold Genes: 2
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 1 (50.00%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Gammaproteobacteria incertae sedis → SAR86 cluster → SAR86 cluster bacterium SAR86E (Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Aquatic → Marine → Coastal → Unclassified → Seawater → Seawater Microbial Communities From Monterey Bay, California, United States

Source Dataset Sampling Location

• Location Name: USA: California
• Coordinates
  • Lat. (^o): 36.8313
  • Long. (^o): -121.9047
  • Depth (m): 5

Associated Families

Family	Category	Number of Sequences	3D Structure?
F033050	Metagenome / Metatranscriptome	178	N

Sequences

Protein ID	Family	RBS	Sequence
Ga0228621_10572541	F033050	N/A	VKLILHQASLNGNAQQQQWKITFKYIIGSKNLDKL