| Basic Information | |
|---|---|
| Taxon OID | 3300028110 Open in IMG/M |
| Scaffold ID | Ga0247584_1159377 Open in IMG/M |
| Source Dataset Name | Metatranscriptome of seawater microbial communities from Monterey Bay, California, United States - 43R (Metagenome Metatranscriptome) |
| Source Dataset Category | Metatranscriptome |
| Source Dataset Use Policy | Open |
| Sequencing Center | DOE Joint Genome Institute (JGI) |
| Sequencing Status | Permanent Draft |
| Scaffold Components | |
|---|---|
| Scaffold Length (bps) | 554 |
| Total Scaffold Genes | 1 (view) |
| Total Scaffold Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
| Novel Protein Genes | 1 (view) |
| Novel Protein Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
| Associated Families | 1 |
| Taxonomy | |
|---|---|
| All Organisms → cellular organisms → Eukaryota → Sar | (Source: UniRef50) |
| Source Dataset Ecosystem |
|---|
| Environmental → Aquatic → Marine → Coastal → Unclassified → Seawater → Seawater Microbial Communities From Monterey Bay, California, United States |
| Source Dataset Sampling Location | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location Name | USA: California | |||||||
| Coordinates | Lat. (o) | 36.8313 | Long. (o) | -121.9047 | Alt. (m) | Depth (m) | 5 | Location on Map |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F049356 | Metatranscriptome | 146 | Y |
| Protein ID | Family | RBS | Sequence |
|---|---|---|---|
| Ga0247584_11593771 | F049356 | N/A | FAKYKCYCDSNAAEKTKEIADGGVAIELLAGEIAELQGENGKLSTENAELEMAMADNERARATADSLRSKANDDFKAEEEDMVNAIGQMDQAIDTLAAIGADQTAAKASLMSQNLRTSKTALIKMKGNVKDALKAASVFLSDKQKRSLTSFIQAPFTGTYQSQSGEIVGILKNMRDTFKSNLAS |
| ⦗Top⦘ |