Scaffold Ga0255184_1001473

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

x

This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK

Scaffold Ga0255184_1001473

Scaffold Ga0255184_1001473

Overview

Basic Information
Taxon OID	3300028091 Open in IMG/M
Scaffold ID	Ga0255184_1001473 Open in IMG/M
Source Dataset Name	Freshwater microbial communities from Mississippi River, Louisiana, United States - Miss_Cont_RepA_0h
Source Dataset Category	Metagenome
Source Dataset Use Policy	Open
Sequencing Center	DOE Joint Genome Institute (JGI)
Sequencing Status	Permanent Draft

Scaffold Components
Scaffold Length (bps)	6928
Total Scaffold Genes	11 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)	4 (36.36%)
Novel Protein Genes	1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)	0 (0.00%)
Associated Families	1

Taxonomy
Not Available	(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Freshwater → River → Unclassified → Freshwater → Freshwater Microbial Communities Amended With Dissolved Organic Matter (Dom) From Various Rivers In The United States

Source Dataset Sampling Location
Location Name	USA: Louisiana
Coordinates	Lat. (^o)	29.8571	Long. (^o)	-89.9778	Alt. (m)		Depth (m)	5
Location on Map

Zoom:	Powered by OpenStreetMap^©

Associated Families

Family	Category	Number of Sequences	3D Structure?
F033772	Metagenome / Metatranscriptome	176	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0255184_100147311	F033772	N/A	PKMPTYLTLDCALRSETDPDAIANLERKGWVVTVPPSYDPATEQAPVWENCGWVVKPLPPPQPYRVSKDTIVSRVLAAGELNDIIALTNGLPEDQAYLWNNFAWFWNTNPTIVGMCTQLGLDPAVILAPDPYLT

© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.