| Basic Information | |
|---|---|
| Taxon OID | 3300028084 Open in IMG/M |
| Scaffold ID | Ga0255356_1021895 Open in IMG/M |
| Source Dataset Name | Peat soil microbial communities from Stordalen Mire, Sweden - H.B.S.T100 |
| Source Dataset Category | Metagenome |
| Source Dataset Use Policy | Open |
| Sequencing Center | DOE Joint Genome Institute (JGI) |
| Sequencing Status | Permanent Draft |
| Scaffold Components | |
|---|---|
| Scaffold Length (bps) | 1613 |
| Total Scaffold Genes | 3 (view) |
| Total Scaffold Genes with Ribosome Binding Sites (RBS) | 2 (66.67%) |
| Novel Protein Genes | 1 (view) |
| Novel Protein Genes with Ribosome Binding Sites (RBS) | 1 (100.00%) |
| Associated Families | 1 |
| Taxonomy | |
|---|---|
| Not Available | (Source: ) |
| Source Dataset Ecosystem |
|---|
| Environmental → Terrestrial → Peat → Unclassified → Unclassified → Soil → Peatland Microbial Communities From Stordalen Mire, Sweden |
| Source Dataset Sampling Location | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location Name | Sweden: Norrbotten County, Stordalen Mire | |||||||
| Coordinates | Lat. (o) | 68.3529 | Long. (o) | 19.0475 | Alt. (m) | Depth (m) | 0 | Location on Map |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F031336 | Metagenome | 182 | N |
| Protein ID | Family | RBS | Sequence |
|---|---|---|---|
| Ga0255356_10218953 | F031336 | AGGAG | VLNGDVIILNPPRDPSWFSDASQSFSLFFWEHSDLIPLLMAEVALAVLIFAGFFWWERRKSKQAVQVGELERMYSAEPISWPR |
| ⦗Top⦘ |