Scaffold Ga0255352_1004066

Overview

Basic Information

• Taxon OID: 3300028082
• Scaffold ID: Ga0255352_1004066
• Source Dataset Name: Peat soil microbial communities from Stordalen Mire, Sweden - H.B.S.T0
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: DOE Joint Genome Institute (JGI)
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 5109
• Total Scaffold Genes: 7
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 4 (57.14%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatomonas → Candidatus Sulfotelmatomonas gaucii (Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Terrestrial → Peat → Unclassified → Unclassified → Soil → Peatland Microbial Communities From Stordalen Mire, Sweden

Source Dataset Sampling Location

• Location Name: Sweden: Norrbotten County, Stordalen Mire
• Coordinates
  • Lat. (^o): 68.3529
  • Long. (^o): 19.0475
  • Depth (m): 0

Associated Families

Family	Category	Number of Sequences	3D Structure?
F046717	Metagenome / Metatranscriptome	151	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0255352_10040665	F046717	N/A	MAILADVAPYSREYHNVRQRVAQQAKGDTELEIEYEKVMNRVKQTRESIIRMNDRHFTAPVDEIAGTVDEVSPGGITLNEYPGRRFQFSSVGMSAADLSARILGEHNDMTRSEVALEVDRRHGAMQE