| Basic Information | |
|---|---|
| Taxon OID | 3300028064 Open in IMG/M |
| Scaffold ID | Ga0268340_1002983 Open in IMG/M |
| Source Dataset Name | Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R1_MAIN_28AUG2017_LD1 |
| Source Dataset Category | Metagenome |
| Source Dataset Use Policy | Open |
| Sequencing Center | DOE Joint Genome Institute (JGI) |
| Sequencing Status | Permanent Draft |
| Scaffold Components | |
|---|---|
| Scaffold Length (bps) | 1426 |
| Total Scaffold Genes | 1 (view) |
| Total Scaffold Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
| Novel Protein Genes | 1 (view) |
| Novel Protein Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
| Associated Families | 1 |
| Taxonomy | |
|---|---|
| All Organisms → Viruses → Predicted Viral | (Source: DeepVirFinder) |
| Source Dataset Ecosystem |
|---|
| Host-Associated → Plants → Phyllosphere → Unclassified → Unclassified → Phyllosphere → Phyllosphere Microbial Comminities From Bioenergy Crops Switchgrass And Miscanthus From Michigan, Usa |
| Source Dataset Sampling Location | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location Name | USA: Michigan | |||||||
| Coordinates | Lat. (o) | 42.39 | Long. (o) | -85.37 | Alt. (m) | Depth (m) | Location on Map | |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F012742 | Metagenome | 277 | Y |
| Protein ID | Family | RBS | Sequence |
|---|---|---|---|
| Ga0268340_10029831 | F012742 | N/A | VHSGPFGCLTKLCAKRAKLVQKFVPRSRDGIFHNEHTQSTPLDPKLTFRCVSYYLGAFGTVWLPYETRCKTDRTSAKVRATKLHRIFRNKGTGSTPCDPKLTFWCVRTIWVHSGLFGCLTKLDAKRDELVQKFVPRSRDGIFRNEHTRSTPLDPKLMFWCVSYYLGAFGT |
| ⦗Top⦘ |