NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0256405_10005649

Scaffold Ga0256405_10005649


Overview

Basic Information
Taxon OID3300028048 Open in IMG/M
Scaffold IDGa0256405_10005649 Open in IMG/M
Source Dataset NameBovine rumen microbial communities from Lethbridge, Alberta, Canada - RJG_02
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)21190
Total Scaffold Genes52 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)14 (26.92%)
Novel Protein Genes2 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Associated Families2

Taxonomy
All Organisms → cellular organisms → Archaea → Euryarchaeota → Methanomada group → Methanobacteria → Methanobacteriales → Methanobacteriaceae → Methanobrevibacter → unclassified Methanobrevibacter → Methanobrevibacter sp.(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Host-Associated → Mammals → Digestive System → Foregut → Rumen → Rumen → Rumen Microbial Communities From Sheep, Dairy Cows And Beef Cattle From Various Locations

Source Dataset Sampling Location
Location NameCanada: Alberta
CoordinatesLat. (o)49.6935Long. (o)-112.8418Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F056169Metagenome / Metatranscriptome138Y
F082008Metagenome / Metatranscriptome113Y

Sequences

Protein IDFamilyRBSSequence
Ga0256405_1000564914F056169N/AMTVKDAIIIARKYNLEAEVRQELASGLTPEQALEEWDIL
Ga0256405_1000564932F082008N/AMGKGRGLLIVRQKSALKRLEAAYEKFKAAGEDKKPWDSTRNGFPVHHKGRSYNEECERLKKEISILKDKISRTHI

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.