Scaffold Ga0256380_1069981

Overview

Basic Information

• Taxon OID: 3300028039
• Scaffold ID: Ga0256380_1069981
• Source Dataset Name: Seawater viral communities from deep brine pools at the bottom of the Mediterranean Sea - LS1 2300m
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: DOE Joint Genome Institute (JGI)
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 508
• Total Scaffold Genes: 2
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 1 (50.00%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 1 (100.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Archaea → TACK group → Candidatus Bathyarchaeota → unclassified Candidatus Bathyarchaeota → Candidatus Bathyarchaeota archaeon (Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Aquatic → Marine → Pelagic → Unclassified → Seawater → Extreme Environments Viral Communities From Various Locations

Source Dataset Sampling Location

• Location Name: Mediterranean Sea
• Coordinates
  • Lat. (^o): 34.0321
  • Long. (^o): 27.821
  • Depth (m): 2300

Associated Families

Family	Category	Number of Sequences	3D Structure?
F026042	Metagenome	199	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0256380_10699811	F026042	GGA	LTFDVLRLLEEEGYIEDGEDNVIYAEKAFFAARVMRWMRNKVQTEPDFDIAAYLTMLLYYKTDMADLRFSEDEDKLLYKMKDLDEEAQQIVNSLIESIGKPVPSPSEEGEDTPSTTEDTDGDSDS