NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0265355_1015020

Scaffold Ga0265355_1015020


Overview

Basic Information
Taxon OID3300028036 Open in IMG/M
Scaffold IDGa0265355_1015020 Open in IMG/M
Source Dataset NameRhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE2
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)653
Total Scaffold Genes2 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)1 (50.00%)
Novel Protein Genes2 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)1 (50.00%)
Associated Families2

Taxonomy
Not Available(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Rhizosphere → Soil, Plant Litter And Rhizosphere Microbial Communities From European Coniferous Forests

Source Dataset Sampling Location
Location NameNorway: Oslo
CoordinatesLat. (o)59.9982Long. (o)10.7894Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F006393Metagenome / Metatranscriptome374Y
F032354Metagenome / Metatranscriptome180Y

Sequences

Protein IDFamilyRBSSequence
Ga0265355_10150201F006393AGGMPESFLGDGLIFEESLPVVWTPGILAEGAQLARLNADNHQLLGAESSLDEVRVHEALKDESPALLHELQRLEYKVNILLRLTAELALRSSGLPAAERVRMSSRALEWFG
Ga0265355_10150202F032354N/ANLARALALSNDMLNAAEKGDVQSVASLDLERMELLKSFRNGTQQVSAADQALLSQINATNDRAIGLVEHLRRGKGRDLDMAAVGRRAVAAYADNRPRR

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.