Scaffold Ga0256382_1162088

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

x

This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK

Scaffold Ga0256382_1162088

Scaffold Ga0256382_1162088

Overview

Basic Information
Taxon OID	3300028022 Open in IMG/M
Scaffold ID	Ga0256382_1162088 Open in IMG/M
Source Dataset Name	Seawater viral communities from deep brine pools at the bottom of the Mediterranean Sea - LS1 750m
Source Dataset Category	Metagenome
Source Dataset Use Policy	Open
Sequencing Center	DOE Joint Genome Institute (JGI)
Sequencing Status	Permanent Draft

Scaffold Components
Scaffold Length (bps)	535
Total Scaffold Genes	2 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)	1 (50.00%)
Novel Protein Genes	1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)	1 (100.00%)
Associated Families	1

Taxonomy
Not Available	(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Marine → Pelagic → Unclassified → Seawater → Extreme Environments Viral Communities From Various Locations

Source Dataset Sampling Location
Location Name	Mediterranean Sea
Coordinates	Lat. (^o)	34.0321	Long. (^o)	27.821	Alt. (m)		Depth (m)	750
Location on Map

Zoom:	Powered by OpenStreetMap^©

Associated Families

Family	Category	Number of Sequences	3D Structure?
F037766	Metagenome	167	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0256382_11620882	F037766	AGGAG	MRRATLEILQDGEKIFGSNTGGKYFVQEFENEQPKGGSFFKTIEEAEKHMVEYETGGSGNSPEFLAE

© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.