| Basic Information | |
|---|---|
| Taxon OID | 3300028022 Open in IMG/M |
| Scaffold ID | Ga0256382_1121505 Open in IMG/M |
| Source Dataset Name | Seawater viral communities from deep brine pools at the bottom of the Mediterranean Sea - LS1 750m |
| Source Dataset Category | Metagenome |
| Source Dataset Use Policy | Open |
| Sequencing Center | DOE Joint Genome Institute (JGI) |
| Sequencing Status | Permanent Draft |
| Scaffold Components | |
|---|---|
| Scaffold Length (bps) | 627 |
| Total Scaffold Genes | 2 (view) |
| Total Scaffold Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
| Novel Protein Genes | 1 (view) |
| Novel Protein Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
| Associated Families | 1 |
| Taxonomy | |
|---|---|
| Not Available | (Source: ) |
| Source Dataset Ecosystem |
|---|
| Environmental → Aquatic → Marine → Pelagic → Unclassified → Seawater → Extreme Environments Viral Communities From Various Locations |
| Source Dataset Sampling Location | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location Name | Mediterranean Sea | |||||||
| Coordinates | Lat. (o) | 34.0321 | Long. (o) | 27.821 | Alt. (m) | Depth (m) | 750 | Location on Map |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F002453 | Metagenome / Metatranscriptome | 558 | Y |
| Protein ID | Family | RBS | Sequence |
|---|---|---|---|
| Ga0256382_11215052 | F002453 | N/A | PIQYPKLYESWYECSRDAHIKSGKILSKMGYRNVNLYKVGMKYHCKAVQTY |
| ⦗Top⦘ |