NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0256382_1041453

Scaffold Ga0256382_1041453


Overview

Basic Information
Taxon OID3300028022 Open in IMG/M
Scaffold IDGa0256382_1041453 Open in IMG/M
Source Dataset NameSeawater viral communities from deep brine pools at the bottom of the Mediterranean Sea - LS1 750m
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)1055
Total Scaffold Genes4 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)4 (100.00%)
Novel Protein Genes1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)1 (100.00%)
Associated Families1

Taxonomy
All Organisms → Viruses → Predicted Viral(Source: DeepVirFinder)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Marine → Pelagic → Unclassified → Seawater → Extreme Environments Viral Communities From Various Locations

Source Dataset Sampling Location
Location NameMediterranean Sea
CoordinatesLat. (o)34.0321Long. (o)27.821Alt. (m)Depth (m)750
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F032683Metagenome179Y

Sequences

Protein IDFamilyRBSSequence
Ga0256382_10414531F032683AGGAMKNYKIRLFGKGVRGEHIIPFNIEPTQEQIENAVIILIEKGLMKLKLESGFHRKDCWTLTYEEVKEDKDKQL

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.