| Basic Information | |
|---|---|
| Taxon OID | 3300028018 Open in IMG/M |
| Scaffold ID | Ga0256381_1072378 Open in IMG/M |
| Source Dataset Name | Seawater viral communities from deep brine pools at the bottom of the Mediterranean Sea - LS1 1600m |
| Source Dataset Category | Metagenome |
| Source Dataset Use Policy | Open |
| Sequencing Center | DOE Joint Genome Institute (JGI) |
| Sequencing Status | Permanent Draft |
| Scaffold Components | |
|---|---|
| Scaffold Length (bps) | 507 |
| Total Scaffold Genes | 2 (view) |
| Total Scaffold Genes with Ribosome Binding Sites (RBS) | 1 (50.00%) |
| Novel Protein Genes | 1 (view) |
| Novel Protein Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
| Associated Families | 1 |
| Taxonomy | |
|---|---|
| All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | (Source: UniRef50) |
| Source Dataset Ecosystem |
|---|
| Environmental → Aquatic → Marine → Pelagic → Unclassified → Seawater → Extreme Environments Viral Communities From Various Locations |
| Source Dataset Sampling Location | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location Name | Mediterranean Sea | |||||||
| Coordinates | Lat. (o) | 34.0321 | Long. (o) | 27.821 | Alt. (m) | Depth (m) | 1600 | Location on Map |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F101861 | Metagenome | 102 | N |
| Protein ID | Family | RBS | Sequence |
|---|---|---|---|
| Ga0256381_10723781 | F101861 | N/A | TLGDVGSVVTVMIRAYFRMQDTPDVRESIEEDVWDAMYQIDSQLRSDANLGGNVSDSSVGAATVGYTNMSGGVFRTVTVPYEMELMGEITITP |
| ⦗Top⦘ |