Basic Information | |
---|---|
Taxon OID | 3300028018 Open in IMG/M |
Scaffold ID | Ga0256381_1037062 Open in IMG/M |
Source Dataset Name | Seawater viral communities from deep brine pools at the bottom of the Mediterranean Sea - LS1 1600m |
Source Dataset Category | Metagenome |
Source Dataset Use Policy | Open |
Sequencing Center | DOE Joint Genome Institute (JGI) |
Sequencing Status | Permanent Draft |
Scaffold Components | |
---|---|
Scaffold Length (bps) | 774 |
Total Scaffold Genes | 3 (view) |
Total Scaffold Genes with Ribosome Binding Sites (RBS) | 2 (66.67%) |
Novel Protein Genes | 1 (view) |
Novel Protein Genes with Ribosome Binding Sites (RBS) | 1 (100.00%) |
Associated Families | 1 |
Taxonomy | |
---|---|
All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → unclassified Cytophagales → Cytophagales bacterium | (Source: UniRef50) |
Source Dataset Ecosystem |
---|
Environmental → Aquatic → Marine → Pelagic → Unclassified → Seawater → Extreme Environments Viral Communities From Various Locations |
Source Dataset Sampling Location | ||||||||
---|---|---|---|---|---|---|---|---|
Location Name | Mediterranean Sea | |||||||
Coordinates | Lat. (o) | 34.0321 | Long. (o) | 27.821 | Alt. (m) | Depth (m) | 1600 | Location on Map |
Zoom: | Powered by OpenStreetMap © |
Family | Category | Number of Sequences | 3D Structure? |
---|---|---|---|
F025149 | Metagenome / Metatranscriptome | 203 | Y |
Protein ID | Family | RBS | Sequence |
---|---|---|---|
Ga0256381_10370622 | F025149 | GGAG | MVAKKKVVKKPAEKQTFLRPEDRLELLEALNKAKSVCDDTLECGSAWCHDVHDANNRIREIARKLGYKQENWYCQFTI |
⦗Top⦘ |