Scaffold Ga0265356_1001322

Overview

Basic Information

• Taxon OID: 3300028017
• Scaffold ID: Ga0265356_1001322
• Source Dataset Name: Rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE4
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: DOE Joint Genome Institute (JGI)
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 3701
• Total Scaffold Genes: 6
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 5 (83.33%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae (Source: IMG/M)

Ecosystem & Geography

Source Dataset Ecosystem: Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Rhizosphere → Soil, Plant Litter And Rhizosphere Microbial Communities From European Coniferous Forests

Source Dataset Sampling Location

• Location Name: Norway: Oslo
• Coordinates
  • Lat. (^o): 59.9992
  • Long. (^o): 10.7901

Associated Families

Family	Category	Number of Sequences	3D Structure?
F014427	Metagenome / Metatranscriptome	263	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0265356_10013221	F014427	N/A	MVGLLFTLQEIVLAKIHGGHVNWAFVVIEFVYWYVWAAYTPLVIGLAKRFPLTGPRFVTHIAIHTITALLMAPLASVT