Scaffold Ga0265353_1003947

Overview

Basic Information

• Taxon OID: 3300028015
• Scaffold ID: Ga0265353_1003947
• Source Dataset Name: Soil microbial communities from Maridalen valley, Oslo, Norway - NSE6
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: DOE Joint Genome Institute (JGI)
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 1189
• Total Scaffold Genes: 2
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 1 (50.00%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 1 (100.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium (Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil → Soil, Plant Litter And Rhizosphere Microbial Communities From European Coniferous Forests

Source Dataset Sampling Location

• Location Name: Norway: Oslo
• Coordinates
  • Lat. (^o): 59.997
  • Long. (^o): 10.7902

Associated Families

Family	Category	Number of Sequences	3D Structure?
F045232	Metagenome / Metatranscriptome	153	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0265353_10039471	F045232	GAG	LPNINQLAKRITIATLAAFAVVYAVDYATFQHKLSTNGGAAALGTVISYYGTALKDGKMEIFTDQPLTETCAHALFPHAGYRPCWFAKGNNVKPIG