Scaffold Ga0247717_1000258

Overview

Basic Information

• Taxon OID: 3300028006
• Scaffold ID: Ga0247717_1000258
• Source Dataset Name: Soil microbial communities from hillslope of Landscape Evolution Observatory, University of Arizona, Oracle, AZ, United States - 2-4-E_N
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: DOE Joint Genome Institute (JGI)
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 16966
• Total Scaffold Genes: 14
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 12 (85.71%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 1 (100.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria (Source: IMG/M)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil → Soil Microbial Communities From Hillslopes Of Landscape Evolution Observatory, University Of Arizona, Oracle, Az, United States

Source Dataset Sampling Location

• Location Name: USA: Arizona
• Coordinates
  • Lat. (^o): 32.5788
  • Long. (^o): -110.8509
  • Depth (m): 0

Associated Families

Family	Category	Number of Sequences	3D Structure?
F081578	Metagenome / Metatranscriptome	114	N

Sequences

Protein ID	Family	RBS	Sequence
Ga0247717_10002583	F081578	GAG	VSNAGHRQELRPHLRDEQVPGDSVIVVRGGPASLATLATHARRTHDALMLDGQSLWGVSVFCALDDIRPSSLDGLLRRFASYRVVHLPRAGQLRAARFELLPSFGRPHFTVRVGDDGPVELGRLFEALGREEPNPYHGRGPGRR