| Basic Information | |
|---|---|
| Taxon OID | 3300028005 Open in IMG/M |
| Scaffold ID | Ga0247708_1002466 Open in IMG/M |
| Source Dataset Name | Soil microbial communities from hillslope of Landscape Evolution Observatory, University of Arizona, Oracle, AZ, United States - 4-2-W_N |
| Source Dataset Category | Metagenome |
| Source Dataset Use Policy | Open |
| Sequencing Center | DOE Joint Genome Institute (JGI) |
| Sequencing Status | Permanent Draft |
| Scaffold Components | |
|---|---|
| Scaffold Length (bps) | 2357 |
| Total Scaffold Genes | 5 (view) |
| Total Scaffold Genes with Ribosome Binding Sites (RBS) | 3 (60.00%) |
| Novel Protein Genes | 1 (view) |
| Novel Protein Genes with Ribosome Binding Sites (RBS) | 1 (100.00%) |
| Associated Families | 1 |
| Taxonomy | |
|---|---|
| All Organisms → cellular organisms → Bacteria | (Source: UniRef50) |
| Source Dataset Ecosystem |
|---|
| Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil → Soil Microbial Communities From Hillslopes Of Landscape Evolution Observatory, University Of Arizona, Oracle, Az, United States |
| Source Dataset Sampling Location | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location Name | USA: Arizona | |||||||
| Coordinates | Lat. (o) | 32.5789 | Long. (o) | -110.8512 | Alt. (m) | Depth (m) | 0 | Location on Map |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F049823 | Metagenome | 146 | Y |
| Protein ID | Family | RBS | Sequence |
|---|---|---|---|
| Ga0247708_10024665 | F049823 | GAGG | MGPAPERARLEVSRGIVPQARIDDALRLLHLDLLEFGHSAETLSTWLWAMHWFPHLNYRDEIVALAEALPAEWRGGQLCDPQILLQFPHVGPEPEISFHVDDEPPWAEGRRYARIVGVPLSPWRRENGGLLVKSDGAPVPVELDPGDAVMLAPDLEHSGGVNQTGSPRYGVYFRWLEER |
| ⦗Top⦘ |