NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0209298_10001971

Scaffold Ga0209298_10001971


Overview

Basic Information
Taxon OID3300027973 Open in IMG/M
Scaffold IDGa0209298_10001971 Open in IMG/M
Source Dataset NameFreshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_140806_EF_MetaG (SPAdes)
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)13002
Total Scaffold Genes17 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)12 (70.59%)
Novel Protein Genes2 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)1 (50.00%)
Associated Families2

Taxonomy
All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake → Freshwater Microbial Communities From Northern Lakes Of Canada To Study Carbon Cycling

Source Dataset Sampling Location
Location NameLake Simoncouche, Canada
CoordinatesLat. (o)48.2311Long. (o)-71.2508Alt. (m)Depth (m)2
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F000273Metagenome / Metatranscriptome1401Y
F031789Metagenome181N

Sequences

Protein IDFamilyRBSSequence
Ga0209298_1000197112F000273AGAAGMTEKLEAKSQLIEKTAFAVFPILFTCVVYLMSALDKLTHDVTVLNAKISLVVTSDNKQAVNSGAELAREKLRQDLEKEIQANRDLIHVNRERIVILEERLKK
Ga0209298_100019713F031789N/AMGRTFVLTGNVTNQSANIYADSPSGQYLFVNHEVASTGQPVYVRISATSGNNAAVANATSGNYGVPIRPAESIVLSGPQCSSGSNVFITYITAAGTANVYVTPGEGR

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.