Scaffold Ga0209401_1003207

Overview

Basic Information

• Taxon OID: 3300027971
• Scaffold ID: Ga0209401_1003207
• Source Dataset Name: Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_140807_MF_MetaG (SPAdes)
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: DOE Joint Genome Institute (JGI)
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 10360
• Total Scaffold Genes: 16
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 12 (75.00%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 1 (100.00%)
• Associated Families: 1

Taxonomy: Not Available (Source: )

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake → Freshwater Microbial Communities From Northern Lakes Of Canada To Study Carbon Cycling

Source Dataset Sampling Location

• Location Name: Lake Montjoie, Canada
• Coordinates
  • Lat. (^o): 45.4091
  • Long. (^o): -72.0994
  • Depth (m): 7

Associated Families

Family	Category	Number of Sequences	3D Structure?
F069829	Metagenome	123	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0209401_100320715	F069829	AGGA	MSWFKRAPRRHEPQKPHVYHPPQNTPATERMLEEAKATGPDKKNKKIKTL