Scaffold Ga0209272_10027340

Overview

Basic Information

• Taxon OID: 3300027967
• Scaffold ID: Ga0209272_10027340
• Source Dataset Name: Marine sediment microbial communities from the Atlantic coast under amendment with organic carbon and nitrate - tdDd00.2 (SPAdes)
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: DOE Joint Genome Institute (JGI)
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 2236
• Total Scaffold Genes: 2
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 1 (50.00%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Pirellulales → Pirellulaceae → Novipirellula → Novipirellula artificiosorum (Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Aquatic → Marine → Coastal → Sediment → Marine Sediment → Marine Sediment Microbial Communities From The Atlantic Coast Under Amendment With Organic Carbon And Nitrate

Source Dataset Sampling Location

• Location Name: Atlantic Coast
• Coordinates

Associated Families

Family	Category	Number of Sequences	3D Structure?
F032659	Metagenome / Metatranscriptome	179	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0209272_100273402	F032659	N/A	AHFAPIQATTGNRRKPDTERPESKHEEKHFREDALPTGKIERQTTQGRADVGDVPTAETLGSLARKVLSSSRHADSRRLARAVLKLLAPFEE