NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0209749_1001269

Scaffold Ga0209749_1001269


Overview

Basic Information
Taxon OID3300027958 Open in IMG/M
Scaffold IDGa0209749_1001269 Open in IMG/M
Source Dataset NameBioremediated contaminated groundwater from EPA Superfund site, New Mexico - Sample SAE3-47 (SPAdes)
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)23607
Total Scaffold Genes28 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)27 (96.43%)
Novel Protein Genes1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)1 (100.00%)
Associated Families1

Taxonomy
All Organisms → cellular organisms → Bacteria → PVC group → Candidatus Omnitrophica(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Engineered → Bioremediation → Tetrachloroethylene And Derivatives → Tetrachloroethylene → Unclassified → Bioremediated Contaminated Groundwater → Bioremediated Contaminated Groundwater Microbial Communities From North Railroad Avenue Plume (Nrap), New Mexico

Source Dataset Sampling Location
Location NameEspanola, New Mexico, United States
CoordinatesLat. (o)35.992Long. (o)-106.0797Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F076867Metagenome117N

Sequences

Protein IDFamilyRBSSequence
Ga0209749_100126910F076867GGAMDEKNRNLVEIAKKKRYIALVEKLGRGSLSSKELKELEEFEKSEQRPAGVIDGTVDLPTLCVYLEKSPRMIRRYVQQGMPVFRDAVGEIARFKVGDVFKWFYKKQGSEDDNGKDYWDKEYRKNRAKLSEIELKQKEGEVIPFEDHVSIVKNQIRGIKAGFLRLPKHIAPKLYQQDPKVICEMLDQEIRYIIEQFAGKQNANKAGKGNS

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.