NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0209820_1012260

Scaffold Ga0209820_1012260


Overview

Basic Information
Taxon OID3300027956 Open in IMG/M
Scaffold IDGa0209820_1012260 Open in IMG/M
Source Dataset NameFreshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (1) Depth 19-21cm May2015 (SPAdes)
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)2125
Total Scaffold Genes7 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)3 (42.86%)
Novel Protein Genes3 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)1 (33.33%)
Associated Families3

Taxonomy
All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Freshwater → Sediment → Unclassified → Freshwater Sediment → Freshwater Sediment Microbial Communities From Cottonwood Lakes Research Site Near Jamestown, North Dakota, Usa

Source Dataset Sampling Location
Location Namenear Jamestown, North Dakota
CoordinatesLat. (o)47.0956Long. (o)-99.1001Alt. (m)Depth (m)0
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F032194Metagenome / Metatranscriptome180N
F060717Metagenome / Metatranscriptome132N
F073146Metagenome / Metatranscriptome120N

Sequences

Protein IDFamilyRBSSequence
Ga0209820_10122603F073146N/AMSEPVSQAVMTVTEVAPFQFAIEIEGSDLSLEVSQIMVKFLNDCLTQIHADQKIH
Ga0209820_10122605F032194GAGGMRNKHCMEAFYRTLKEVDIPSGQSMICEHFFAAGWDAAIDALSLAYQRQFENDGVDTQLIRRDPQEPPADDDKE
Ga0209820_10122607F060717N/AADVQPDNVCFECGKAWGTHPLKSSENHRSWIDQCDVCLKLTAVVDVSEYGYMKENWDGKKVV

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.