Scaffold Ga0208151_104522

Overview

Basic Information

• Taxon OID: 3300027937
• Scaffold ID: Ga0208151_104522
• Source Dataset Name: Hot spring microbial mat communities from Yellowstone National Park, Wyoming, USA - ECH_B host_MetaG (SPAdes)
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: DOE Joint Genome Institute (JGI)
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 2724
• Total Scaffold Genes: 6
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 3 (50.00%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Archaea → TACK group → Candidatus Marsarchaeota → Candidatus Marsarchaeota group 1 → Candidatus Marsarchaeota G1 archaeon OSP_D (Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Aquatic → Thermal Springs → Hot (42-90C) → Unclassified → Hot Spring → Extremophilic Microbial Mat Communities From Usa And Mexico

Source Dataset Sampling Location

• Location Name: USA: Yellowstone National Park
• Coordinates
  • Lat. (^o): 44.7219
  • Long. (^o): -110.7021

Associated Families

Family	Category	Number of Sequences	3D Structure?
F066922	Metagenome / Metatranscriptome	126	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0208151_1045223	F066922	N/A	MSETDHINEELEKLKSVVSEKIQKFASDRTIRRYVARLEKLELSKVSAEQAIRVIAIFLSTPLGQWLITVILLELLAKAHFFSEIQVDILIGLITGSELLQALAKSGVLTQIAGLAGLF