NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0208151_100714

Scaffold Ga0208151_100714


Overview

Basic Information
Taxon OID3300027937 Open in IMG/M
Scaffold IDGa0208151_100714 Open in IMG/M
Source Dataset NameHot spring microbial mat communities from Yellowstone National Park, Wyoming, USA - ECH_B host_MetaG (SPAdes)
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)12434
Total Scaffold Genes19 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)16 (84.21%)
Novel Protein Genes1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)1 (100.00%)
Associated Families1

Taxonomy
All Organisms → cellular organisms → Archaea → DPANN group(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Thermal Springs → Hot (42-90C) → Unclassified → Hot Spring → Extremophilic Microbial Mat Communities From Usa And Mexico

Source Dataset Sampling Location
Location NameUSA: Yellowstone National Park
CoordinatesLat. (o)44.7219Long. (o)-110.7021Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F095753Metagenome / Metatranscriptome105N

Sequences

Protein IDFamilyRBSSequence
Ga0208151_10071416F095753AGGMPSINQSYAGMEAGVYFFKPAHDLQIGKYISLVEQGYERHIAKDGKHIYLLFLKVKK

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.