| Basic Information | |
|---|---|
| Taxon OID | 3300027933 Open in IMG/M |
| Scaffold ID | Ga0208549_105833 Open in IMG/M |
| Source Dataset Name | Hot spring microbial mat communities from Yellowstone National Park, Wyoming, USA - BED_host_MetaG (SPAdes) |
| Source Dataset Category | Metagenome |
| Source Dataset Use Policy | Open |
| Sequencing Center | DOE Joint Genome Institute (JGI) |
| Sequencing Status | Permanent Draft |
| Scaffold Components | |
|---|---|
| Scaffold Length (bps) | 2558 |
| Total Scaffold Genes | 5 (view) |
| Total Scaffold Genes with Ribosome Binding Sites (RBS) | 4 (80.00%) |
| Novel Protein Genes | 2 (view) |
| Novel Protein Genes with Ribosome Binding Sites (RBS) | 2 (100.00%) |
| Associated Families | 2 |
| Taxonomy | |
|---|---|
| All Organisms → cellular organisms → Bacteria → Elusimicrobia → unclassified Elusimicrobiota → Elusimicrobia bacterium GWA2_38_7 | (Source: UniRef50) |
| Source Dataset Ecosystem |
|---|
| Environmental → Aquatic → Thermal Springs → Hot (42-90C) → Unclassified → Hot Spring → Extremophilic Microbial Mat Communities From Usa And Mexico |
| Source Dataset Sampling Location | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location Name | USA: Yellowstone National Park | |||||||
| Coordinates | Lat. (o) | 44.7315 | Long. (o) | -110.7113 | Alt. (m) | Depth (m) | Location on Map | |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F077501 | Metagenome / Metatranscriptome | 117 | Y |
| F092366 | Metagenome / Metatranscriptome | 107 | Y |
| Protein ID | Family | RBS | Sequence |
|---|---|---|---|
| Ga0208549_1058333 | F077501 | GAGG | MNKKLLSLLILFSLLIPLVNASSNSNLSITFIPEGMSQTYYVNIHNLNNSFNTTFEFNGIGEVTNLTSGIYYIKITSRNYNTLNIKLNLTQNITLELFFNSNIIGYGIQNYYYPIFTAMLIIALFGVLITMVYYMKGVKIK |
| Ga0208549_1058335 | F092366 | AGGA | MKAIYVLFIVLLFLIPFSFNNSQASLLSGSSLINEKINTHIQIYVLNLTLPNAWGVYGYYNYSINNKNYSIKISNITDNYYLDLNISYEISISLNSTLYYNISLFAYKLQDYIALNHINYKGKLNISITQKEYNITLNASAIQFENVNNFYYFWSEYGYKIIGSIII |
| ⦗Top⦘ |