Basic Information | |
---|---|
Taxon OID | 3300027932 Open in IMG/M |
Scaffold ID | Ga0208429_107102 Open in IMG/M |
Source Dataset Name | Hot spring microbial mat communities from Yellowstone National Park, Wyoming, USA - BED_virus_MetaG (SPAdes) |
Source Dataset Category | Metagenome |
Source Dataset Use Policy | Open |
Sequencing Center | DOE Joint Genome Institute (JGI) |
Sequencing Status | Permanent Draft |
Scaffold Components | |
---|---|
Scaffold Length (bps) | 1028 |
Total Scaffold Genes | 4 (view) |
Total Scaffold Genes with Ribosome Binding Sites (RBS) | 2 (50.00%) |
Novel Protein Genes | 1 (view) |
Novel Protein Genes with Ribosome Binding Sites (RBS) | 1 (100.00%) |
Associated Families | 1 |
Taxonomy | |
---|---|
Not Available | (Source: ) |
Source Dataset Ecosystem |
---|
Environmental → Aquatic → Thermal Springs → Hot (42-90C) → Unclassified → Hot Spring → Extremophilic Microbial Mat Communities From Usa And Mexico |
Source Dataset Sampling Location | ||||||||
---|---|---|---|---|---|---|---|---|
Location Name | USA: Yellowstone National Park | |||||||
Coordinates | Lat. (o) | 44.7315 | Long. (o) | -110.7113 | Alt. (m) | Depth (m) | Location on Map | |
Zoom: | Powered by OpenStreetMap © |
Family | Category | Number of Sequences | 3D Structure? |
---|---|---|---|
F063847 | Metagenome / Metatranscriptome | 129 | Y |
Protein ID | Family | RBS | Sequence |
---|---|---|---|
Ga0208429_1071022 | F063847 | AGGGGG | MRFKKYVFCYDQYSYLQDRMITHHVSIYAKSLKEAESKLEKLGYKDIYLKKKKRKVSY |
⦗Top⦘ |