NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0208429_101350

Scaffold Ga0208429_101350


Overview

Basic Information
Taxon OID3300027932 Open in IMG/M
Scaffold IDGa0208429_101350 Open in IMG/M
Source Dataset NameHot spring microbial mat communities from Yellowstone National Park, Wyoming, USA - BED_virus_MetaG (SPAdes)
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)3204
Total Scaffold Genes8 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)5 (62.50%)
Novel Protein Genes3 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)2 (66.67%)
Associated Families3

Taxonomy
All Organisms → cellular organisms → Archaea → Euryarchaeota → unclassified Euryarchaeota → Euryarchaeota archaeon(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Thermal Springs → Hot (42-90C) → Unclassified → Hot Spring → Extremophilic Microbial Mat Communities From Usa And Mexico

Source Dataset Sampling Location
Location NameUSA: Yellowstone National Park
CoordinatesLat. (o)44.7315Long. (o)-110.7113Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F026606Metagenome / Metatranscriptome197Y
F050482Metagenome / Metatranscriptome145Y
F103566Metagenome / Metatranscriptome101N

Sequences

Protein IDFamilyRBSSequence
Ga0208429_1013502F103566AGGGGGMNAKERIRIERKIEDRKRMIQIEEMKRMLGQFFERIDWDLERLEEGGDKNEQASLPQWRQ
Ga0208429_1013506F026606N/AMTSKVYIHVCNIYIGDKKMDEGNEYEKIEQKLEEFIGVEVGELKDEIVEKAVWLDKDYSKMVVLRIYPDGSYDVGIGQQGSHDGLSSKERLWVEFSLIEPWDLPEYETVVGVVGGYIDEDSGDVFDDDELLDAVRTSVASGFYDDFEYEWKKFLKEFDEWYEALKGNGEWENES
Ga0208429_1013507F050482GGAGMNHKMMEQELEEMGFKIIDVKNRFPSHTYHIYAVLKNGYALSICQGIGVHGSFVRVPYSDQQTFEVALGRYVGGVFYLIYEGKWKDDVLGWQTPENVIELAKSVKRLRL

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.