Scaffold Ga0208312_100182

Overview

Basic Information

• Taxon OID: 3300027931
• Scaffold ID: Ga0208312_100182
• Source Dataset Name: Extremophilic microbial mat communities from Yellowstone National Park, USA - BED_Mat_virus_9_15 (SPAdes)
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: DOE Joint Genome Institute (JGI)
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 6092
• Total Scaffold Genes: 8
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 3 (37.50%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Associated Families: 1

Taxonomy: Not Available (Source: )

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Aquatic → Thermal Springs → Hot (42-90C) → Unclassified → Hot Spring → Extremophilic Microbial Mat Communities From Usa And Mexico

Source Dataset Sampling Location

• Location Name: Yellowstone National Park, USA
• Coordinates
  • Lat. (^o): 44.7315
  • Long. (^o): -110.7113

Associated Families

Family	Category	Number of Sequences	3D Structure?
F035135	Metagenome / Metatranscriptome	173	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0208312_1001826	F035135	N/A	MTYVNEKFTTPLRQKRIHVIPHSVKYGQQFITSFFFDVVDDEEYQYLIFTFMMKNAFKIYLNVWRQQREFISYLKTFKNEFKDAFDYYQQLLITTKERIYETTHTIACFFDFDNDINEILTIYVNELFCDYVDNALR