NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0209536_103094696

Scaffold Ga0209536_103094696


Overview

Basic Information
Taxon OID3300027917 Open in IMG/M
Scaffold IDGa0209536_103094696 Open in IMG/M
Source Dataset NameMarine sediment microbial communities from White Oak River estuary, North Carolina - WOR-2-8_12 (SPAdes)
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)533
Total Scaffold Genes2 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)1 (50.00%)
Novel Protein Genes1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Associated Families1

Taxonomy
Not Available(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Marine → Oceanic → Sediment → Marine Sediment → Marine Sediment Microbial Communities From White Oak River Estuary, North Carolina

Source Dataset Sampling Location
Location NameWhite Oak River estuary, North Carolina, USA
CoordinatesLat. (o)34.640199Long. (o)-77.109447Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F011300Metagenome / Metatranscriptome292Y

Sequences

Protein IDFamilyRBSSequence
Ga0209536_1030946961F011300N/AHSWSMVMLFAVILLGTYLLIMALGNSDVDDDDDFGGGMMIPATVPTP

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.