Scaffold Ga0209536_100170899

Overview

Basic Information

• Taxon OID: 3300027917
• Scaffold ID: Ga0209536_100170899
• Source Dataset Name: Marine sediment microbial communities from White Oak River estuary, North Carolina - WOR-2-8_12 (SPAdes)
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: DOE Joint Genome Institute (JGI)
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 2739
• Total Scaffold Genes: 7
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 6 (85.71%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 1 (100.00%)
• Associated Families: 1

Taxonomy: All Organisms → Viruses → Predicted Viral (Source: DeepVirFinder)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Aquatic → Marine → Oceanic → Sediment → Marine Sediment → Marine Sediment Microbial Communities From White Oak River Estuary, North Carolina

Source Dataset Sampling Location

• Location Name: White Oak River estuary, North Carolina, USA
• Coordinates
  • Lat. (^o): 34.640199
  • Long. (^o): -77.109447

Associated Families

Family	Category	Number of Sequences	3D Structure?
F076592	Metagenome	118	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0209536_1001708994	F076592	AGGA	MAYLIQDITFYKIDEEGNEVLNEDGTTKIYRIKKAVRVKALEYLTEDFDDDMMIEEDKYH