NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0209536_100073879

Scaffold Ga0209536_100073879


Overview

Basic Information
Taxon OID3300027917 Open in IMG/M
Scaffold IDGa0209536_100073879 Open in IMG/M
Source Dataset NameMarine sediment microbial communities from White Oak River estuary, North Carolina - WOR-2-8_12 (SPAdes)
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)4387
Total Scaffold Genes9 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)2 (22.22%)
Novel Protein Genes2 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)1 (50.00%)
Associated Families2

Taxonomy
All Organisms → Viruses → Predicted Viral(Source: DeepVirFinder)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Marine → Oceanic → Sediment → Marine Sediment → Marine Sediment Microbial Communities From White Oak River Estuary, North Carolina

Source Dataset Sampling Location
Location NameWhite Oak River estuary, North Carolina, USA
CoordinatesLat. (o)34.640199Long. (o)-77.109447Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F042288Metagenome / Metatranscriptome158Y
F088643Metagenome109N

Sequences

Protein IDFamilyRBSSequence
Ga0209536_1000738794F088643GAGMNKEEKKAIIDILAKWRDMIGVDGRSVDILIDRVNQIYIPESINIQEVDVIKADIAEMCSQIKYDVKQNKVRGPENTTKRMAIYKASEIKYGRTSSMECAIKEFFDKDRTTLLHWRNKSDDFIDIKDPMFVRYVNELLT
Ga0209536_1000738795F042288N/AMKGKVKVIVRVAVEHPDAETFNCLGNKIVLKAESYDHAYEFAMTILNLRDTKMFEYGDLMFFNKGILIEIDR

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.