| Basic Information | |
|---|---|
| Taxon OID | 3300027911 Open in IMG/M |
| Scaffold ID | Ga0209698_10344969 Open in IMG/M |
| Source Dataset Name | Freshwater sediment microbial communities from Pennsylvania, USA - Little Laurel Run_MetaG_LLR_2012 (SPAdes) |
| Source Dataset Category | Metagenome |
| Source Dataset Use Policy | Open |
| Sequencing Center | DOE Joint Genome Institute (JGI) |
| Sequencing Status | Permanent Draft |
| Scaffold Components | |
|---|---|
| Scaffold Length (bps) | 1171 |
| Total Scaffold Genes | 2 (view) |
| Total Scaffold Genes with Ribosome Binding Sites (RBS) | 1 (50.00%) |
| Novel Protein Genes | 1 (view) |
| Novel Protein Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
| Associated Families | 1 |
| Taxonomy | |
|---|---|
| All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → unclassified Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter sp. SbA7 | (Source: UniRef50) |
| Source Dataset Ecosystem |
|---|
| Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds → Freshwater And Sediment Microbial Communities From Various Areas In North America, Analyzing Microbe Dynamics In Response To Fracking |
| Source Dataset Sampling Location | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location Name | USA: Pennsylvania, Clearfield County | |||||||
| Coordinates | Lat. (o) | 41.170727 | Long. (o) | -78.4726 | Alt. (m) | Depth (m) | Location on Map | |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F013793 | Metagenome / Metatranscriptome | 268 | Y |
| Protein ID | Family | RBS | Sequence |
|---|---|---|---|
| Ga0209698_103449691 | F013793 | N/A | HNAGWQLFLHMGKDQVVHHDLDYAGYTGNANILSPLPLSMGKLAAVTVYYKLNPYVTFGFEQSLYATRIKDGIPAYTIAGKPSNEWQDHRSEFGPIFTF |
| ⦗Top⦘ |