NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0209698_10076808

Scaffold Ga0209698_10076808


Overview

Basic Information
Taxon OID3300027911 Open in IMG/M
Scaffold IDGa0209698_10076808 Open in IMG/M
Source Dataset NameFreshwater sediment microbial communities from Pennsylvania, USA - Little Laurel Run_MetaG_LLR_2012 (SPAdes)
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)2841
Total Scaffold Genes5 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)5 (100.00%)
Novel Protein Genes3 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)3 (100.00%)
Associated Families3

Taxonomy
All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds → Freshwater And Sediment Microbial Communities From Various Areas In North America, Analyzing Microbe Dynamics In Response To Fracking

Source Dataset Sampling Location
Location NameUSA: Pennsylvania, Clearfield County
CoordinatesLat. (o)41.170727Long. (o)-78.4726Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F000673Metagenome / Metatranscriptome944Y
F002076Metagenome / Metatranscriptome596Y
F049783Metagenome / Metatranscriptome146Y

Sequences

Protein IDFamilyRBSSequence
Ga0209698_100768082F000673AGGAMAKPRIERSLLFPNREFRERVRKASKDRGFRSEQAFILAACEREIRRGDDTESVTQFEARIAATLTNLAKQGQHLQTLVEAQVAITDVLLKYVITCVVEPPEDALPAARVRARLRYDKLIRAAAKELSNKNRDTLREMVADD
Ga0209698_100768083F002076AGGMQKDYRLCLEKLAGEPPRRKAAIIRSLLPGIETALDSGQSLKDIWEALGNEGLQMSYHVFHMTVWRARKTGKPTATSSWGKRDKPFESQGLREARVETVEGRDPFANLRRLEEDRPGFHWRGTRSLKTLVRGTEGTNDKSNR
Ga0209698_100768085F049783GGAMGELSTSINDALLAVDLKTVELVTLQSRQKQTGRETQVVILNRLRKRIHEIAKKRNCSMNQLVNSALLAYYSKAGESKFKKTPKGREASLRSYDTMSESERRELHRMLAGLSAMKSVPLEAEEPNGT

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.