NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0209698_10001029

Scaffold Ga0209698_10001029


Overview

Basic Information
Taxon OID3300027911 Open in IMG/M
Scaffold IDGa0209698_10001029 Open in IMG/M
Source Dataset NameFreshwater sediment microbial communities from Pennsylvania, USA - Little Laurel Run_MetaG_LLR_2012 (SPAdes)
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)32134
Total Scaffold Genes30 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)27 (90.00%)
Novel Protein Genes3 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)3 (100.00%)
Associated Families3

Taxonomy
All Organisms → cellular organisms → Bacteria(Source: IMG/M)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds → Freshwater And Sediment Microbial Communities From Various Areas In North America, Analyzing Microbe Dynamics In Response To Fracking

Source Dataset Sampling Location
Location NameUSA: Pennsylvania, Clearfield County
CoordinatesLat. (o)41.170727Long. (o)-78.4726Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F000437Metagenome / Metatranscriptome1146Y
F008715Metagenome / Metatranscriptome329Y
F009766Metagenome / Metatranscriptome313Y

Sequences

Protein IDFamilyRBSSequence
Ga0209698_1000102919F000437GAGGLRSRSFSIALATLSLAICALPLRVLPQSTEKKALWKSVEFAIVKFNDEAPKSWNIYHTEKKGLLLVHLWKRYLLVDMKEQEVYEIDPQTVKPNGDAVEWSLADKPAEPMETPDWKTKDLRSMELVKFRLGKDGHFLEMQLPLLINGKPVY
Ga0209698_1000102920F009766GGCGGMFRRRLLKRTAVFLTGSLLFPYVSQIYPPLDLDLMLVFFGVLFFIALAIAVFLDREARNRREIEVLKRIYSGFIPLPWILAATLLVNGKLDSRKNVAYHPTTVDSRYNMPGIVRGTRRLFVHSWREGQKIERLAVDFDDYDRFRAGDSVVVGVEPGALGIPWYYGVYRR
Ga0209698_1000102926F008715AGGVRDWEALVERQLRGLALEPAEIAEVVAELSAHLDETCEELRRRGMTEEQAVQRTLSQVEDWQKLSRLIERARTKENVMTNRVKQFWLPSLLTLFLSMGLLMLVQFFGPNPWVIARKSAWSLIAPVAVIYLPWLFSLPLIGAMGAYLSNRAGGSRRAMLTSIVFPVLPYFAFFLVALPVTAIFNDRLGHNIMFLALFVGLLAWVVAPAGALLAGGALVQFFLSRRLDSRRIVGS
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.