NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0207428_10000670

Scaffold Ga0207428_10000670


Overview

Basic Information
Taxon OID3300027907 Open in IMG/M
Scaffold IDGa0207428_10000670 Open in IMG/M
Source Dataset NamePopulus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes)
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)40011
Total Scaffold Genes46 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)34 (73.91%)
Novel Protein Genes2 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)2 (100.00%)
Associated Families2

Taxonomy
All Organisms → cellular organisms → Bacteria(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere → Populus Root And Rhizosphere Microbial Communities From Tennessee, Usa

Source Dataset Sampling Location
Location NameUSA: Tennessee
CoordinatesLat. (o)35.8444Long. (o)-83.9599Alt. (m)Depth (m)0
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F005151Metagenome / Metatranscriptome410Y
F022557Metagenome214Y

Sequences

Protein IDFamilyRBSSequence
Ga0207428_1000067011F022557GGAGGMIEFILSGVQLACLQAAVTIGSEESSVLGRAMSFGSKLFSPAPFAVQCTLEIANRLLSVAQRFCPDCVPEIRAAIEQRRSTEAT
Ga0207428_1000067015F005151GGAGMDQESLRLLIRHKLGDGRLPHDGLRRVVSSPSAGEKCDACDAIVAMDQLLMEGITLDLGRRPLQFHVLCFEIWDHERRVT

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.