NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0209415_10100894

Scaffold Ga0209415_10100894


Overview

Basic Information
Taxon OID3300027905 Open in IMG/M
Scaffold IDGa0209415_10100894 Open in IMG/M
Source Dataset NamePeat soil microbial communities from Weissenstadt, Germany - SII-SIP-2007 (SPAdes)
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)3168
Total Scaffold Genes5 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)3 (60.00%)
Novel Protein Genes3 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)2 (66.67%)
Associated Families3

Taxonomy
Not Available(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil → Peatlands Soil Microbial Communities From Germany And Austria, That Are Sulfate Reducing

Source Dataset Sampling Location
Location NameGermany: Weissenstadt
CoordinatesLat. (o)50.13Long. (o)11.88Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F013515Metagenome / Metatranscriptome270N
F016695Metagenome / Metatranscriptome245Y
F035282Metagenome / Metatranscriptome172N

Sequences

Protein IDFamilyRBSSequence
Ga0209415_101008941F013515GAGGMTAPAYPFSARDIFGDLRSRLAAEHRRPMGFERLAKMLGRSKSTTYNWFAIFHHPHVLGFLCLLERLPPAERHSFIEAHCRAYSTLDDPRLAHAPGKTGQLLELLDQKAGLTIITGGTDFSRTFVFTALAHAASRADGKLPAAAGIDLHRSNLFVPVESLIYINGDLGPDHARRLTHKIWPRVLTSGAPRLFLNGVWSAVPEVRDDLLRCARFKHVIIAEQGMPDVRHLKAKVSTPIHVLTLSTAKSMAERILVNCRRVQRAKRPGN
Ga0209415_101008942F016695N/AMHYNQIIAVLREHGFAEGRLIANSKSGYYKRHRSHFVVFNAQVCSLGGRVLKQADLDLTLDGEKLTQAARAAGENFYVLYENDPSPFWKPGSTPMPRVLRDAVWWTRIHREDEDLFLPMNSGPLKRERGRLRCSLGRWQNQPAYSVDLLDNPAWGSGRNMSGAVVQVLGHPPRGLRPAEKDEVFTAETSKGRGCPVRPVFYHRVGLLDYVWFSHGAAVPAILYDHIVRRLDSVRFTWHRDSVAIHLRQAGAVVGLFWPCHISAPEVLAKARRRLFRRFAKRTEAAENPR
Ga0209415_101008944F035282GGAGMKIIVLWPFILLVRVIAHFDPHLFRYWAVHSMDHWRFWGTTWKGYAIGLAGWAILMGGLYSLVVWLW
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.