NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0209488_10050277

Scaffold Ga0209488_10050277


Overview

Basic Information
Taxon OID3300027903 Open in IMG/M
Scaffold IDGa0209488_10050277 Open in IMG/M
Source Dataset NameVadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_2 (SPAdes)
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)3065
Total Scaffold Genes6 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)5 (83.33%)
Novel Protein Genes3 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)2 (66.67%)
Associated Families3

Taxonomy
All Organisms → cellular organisms → Bacteria → Acidobacteria(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil → Vadose Zone Soil And Rhizosphere Microbial Communities From The Eel River Critical Zone Observatory, Northern California To Study Diel Carbon Cycling

Source Dataset Sampling Location
Location NameUSA: California, Eel River Critical Zone Observatory
CoordinatesLat. (o)39.7291Long. (o)-123.6419Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F001356Metagenome / Metatranscriptome716Y
F002523Metagenome / Metatranscriptome552Y
F016609Metagenome / Metatranscriptome246Y

Sequences

Protein IDFamilyRBSSequence
Ga0209488_100502772F016609AGGAGGMMTATYKWFEPYKAALLETDWSKMPERIQAAEAALSQREREFDLDHGGTPEENQAIADAMRGLTVLRNDAIKWSEKQKPPRGKSA
Ga0209488_100502773F001356GGAGGMGKDSKASDKPPALKYRQVKINGLDKTRRGKHYDLVLGILQQLRTLPPGSAMEIPLAEVGGIGLANLRSAVHRASTSHELEIETLADEKNFYVWRKKVEKEL
Ga0209488_100502776F002523N/AIISLSRLEDNRLAIRVARPQHDSNPVHEYLFVQDVRGTLSDFGISDGVIDSHLKLLAQMGASEQLKFPPMDVPQHELRSKGFRL

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.