| Basic Information | |
|---|---|
| Taxon OID | 3300027897 Open in IMG/M |
| Scaffold ID | Ga0209254_10678042 Open in IMG/M |
| Source Dataset Name | Freshwater lake sediment microbial communities from the University of Notre Dame, USA, for methane emissions studies - DIP11 DI (SPAdes) |
| Source Dataset Category | Metagenome |
| Source Dataset Use Policy | Open |
| Sequencing Center | DOE Joint Genome Institute (JGI) |
| Sequencing Status | Permanent Draft |
| Scaffold Components | |
|---|---|
| Scaffold Length (bps) | 714 |
| Total Scaffold Genes | 2 (view) |
| Total Scaffold Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
| Novel Protein Genes | 1 (view) |
| Novel Protein Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
| Associated Families | 1 |
| Taxonomy | |
|---|---|
| All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Xanthomonadales → unclassified Xanthomonadales → Xanthomonadales bacterium | (Source: UniRef50) |
| Source Dataset Ecosystem |
|---|
| Environmental → Aquatic → Freshwater → Lentic → Sediment → Freshwater Lake Sediment → Freshwater Lake Sediment Microbial Communities From The University Of Notre Dame, Usa, Of Lakes That Contribute To Methane Emissions |
| Source Dataset Sampling Location | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location Name | University of Notre Dame, Indiana, USA | |||||||
| Coordinates | Lat. (o) | 41.7 | Long. (o) | -86.23 | Alt. (m) | Depth (m) | Location on Map | |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F045180 | Metagenome | 153 | Y |
| Protein ID | Family | RBS | Sequence |
|---|---|---|---|
| Ga0209254_106780422 | F045180 | N/A | FVGWLVVAQAVFHLARRQRSVDVFLIVIAAVLVGRTFTAGNTLEFAELAAIALLLPVLVLISRVEDRGRSALLAAALGTWLASVALLPALDGARDVAVELPAIREFLGRNAPPPAELAGRAFSYVALTWLLAGTGLYPHVAAGITVLLVVLLGLMQAGATTPVYGWIDVVIAVIAGILITRWTPRN |
| ⦗Top⦘ |