NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0209777_10514504

Scaffold Ga0209777_10514504


Overview

Basic Information
Taxon OID3300027896 Open in IMG/M
Scaffold IDGa0209777_10514504 Open in IMG/M
Source Dataset NameFreshwater lake sediment microbial communities from the University of Notre Dame, USA, for methane emissions studies -HBP12 HB (SPAdes)
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)880
Total Scaffold Genes3 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)2 (66.67%)
Novel Protein Genes1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)1 (100.00%)
Associated Families1

Taxonomy
All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Freshwater → Lentic → Sediment → Freshwater Lake Sediment → Freshwater Lake Sediment Microbial Communities From The University Of Notre Dame, Usa, Of Lakes That Contribute To Methane Emissions

Source Dataset Sampling Location
Location NameUniversity of Notre Dame, Indiana, USA
CoordinatesLat. (o)41.7Long. (o)-86.23Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F050094Metagenome / Metatranscriptome145Y

Sequences

Protein IDFamilyRBSSequence
Ga0209777_105145041F050094GGAMITLHDAIYALNPSVVTIRGDVAYDANEQEVAYDKSAAQAKLAEL

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.