Scaffold Ga0209777_10158041

Overview

Basic Information

• Taxon OID: 3300027896
• Scaffold ID: Ga0209777_10158041
• Source Dataset Name: Freshwater lake sediment microbial communities from the University of Notre Dame, USA, for methane emissions studies -HBP12 HB (SPAdes)
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: DOE Joint Genome Institute (JGI)
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 1861
• Total Scaffold Genes: 3
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 1 (33.33%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 1 (100.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium SCN 57-15 (Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Aquatic → Freshwater → Lentic → Sediment → Freshwater Lake Sediment → Freshwater Lake Sediment Microbial Communities From The University Of Notre Dame, Usa, Of Lakes That Contribute To Methane Emissions

Source Dataset Sampling Location

• Location Name: University of Notre Dame, Indiana, USA
• Coordinates
  • Lat. (^o): 41.7
  • Long. (^o): -86.23

Associated Families

Family	Category	Number of Sequences	3D Structure?
F061478	Metagenome	131	N

Sequences

Protein ID	Family	RBS	Sequence
Ga0209777_101580413	F061478	AGG	MQAATIEIHYDGTPMEVFQQIRVGRLLLYNAAARDRLGIVQETWKRGALGKTFLVRPIAGQILGEEVVDSAGRVIAVFGLAITNAFLPDPRPQRE