NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0209068_10000887

Scaffold Ga0209068_10000887


Overview

Basic Information
Taxon OID3300027894 Open in IMG/M
Scaffold IDGa0209068_10000887 Open in IMG/M
Source Dataset NameFreshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Cold Stream Run_MetaG_CSR_2012 (SPAdes)
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)15333
Total Scaffold Genes16 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)12 (75.00%)
Novel Protein Genes3 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)3 (100.00%)
Associated Families3

Taxonomy
All Organisms → cellular organisms → Bacteria(Source: IMG/M)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds → Freshwater And Sediment Microbial Communities From Various Areas In North America, Analyzing Microbe Dynamics In Response To Fracking

Source Dataset Sampling Location
Location NamePennsylvania, USA
CoordinatesLat. (o)41.1289Long. (o)-78.4195Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F015254Metagenome / Metatranscriptome256Y
F019612Metagenome / Metatranscriptome228Y
F063437Metagenome / Metatranscriptome129Y

Sequences

Protein IDFamilyRBSSequence
Ga0209068_100008872F063437AGGAGGMPKVLVCVFCSEEIEAQEKWLNVPGRTNEAAHLKCWKENNRPEVRSRST
Ga0209068_100008878F019612AGGCGGMHDRGAGRRCLRTLTACLLLSMIAVSDGLAGEWEHMRESYDNELRAQAKRIAEIEARERRVPADQETRADKITRDRITGIKGSLKSGGKTRSLADTAERASGDARALIDLYREQGEYRDIVMSEWDAEGAERRKLRESIAALRKSLERANADLATAIEIAETTTMRVPQSGVLEQVARIEAGEKERARWLREQAALDRERQQRERGAAERERGVR
Ga0209068_100008879F015254GGAGMLQLLLVLLGRMRRGAPHLRSSGLPLMSLAVVVVGCASPSLLPEAQAVAIQDRDRALALHADAIHAAISQSAKVGALVFLDATDSHLVVLPGESPADAWARYTLLPENGTGRVSMPPVLTFVHRADVPKAPETIPRSVLQQEAQLRDAWRRIEERLSIVQSDLAESKREADASLTGARADMHAALSSLAEDLAAVRKFMLQTAQLGWLNHELTVENETGIRKVATASQELSASSARLEDLMRELPKRLAGQLEELANRLDSIQGKVSSLK
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.