| Basic Information | |
|---|---|
| Taxon OID | 3300027893 Open in IMG/M |
| Scaffold ID | Ga0209636_11104899 Open in IMG/M |
| Source Dataset Name | Marine sediment microbial communities from White Oak River estuary, North Carolina - WOR-1-52-54 (SPAdes) |
| Source Dataset Category | Metagenome |
| Source Dataset Use Policy | Open |
| Sequencing Center | DOE Joint Genome Institute (JGI) |
| Sequencing Status | Permanent Draft |
| Scaffold Components | |
|---|---|
| Scaffold Length (bps) | 570 |
| Total Scaffold Genes | 1 (view) |
| Total Scaffold Genes with Ribosome Binding Sites (RBS) | 1 (100.00%) |
| Novel Protein Genes | 1 (view) |
| Novel Protein Genes with Ribosome Binding Sites (RBS) | 1 (100.00%) |
| Associated Families | 1 |
| Taxonomy | |
|---|---|
| Not Available | (Source: ) |
| Source Dataset Ecosystem |
|---|
| Environmental → Aquatic → Marine → Oceanic → Sediment → Marine Sediment → Marine Sediment Microbial Communities From White Oak River Estuary, North Carolina |
| Source Dataset Sampling Location | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location Name | White Oak River estuary, North Carolina, USA | |||||||
| Coordinates | Lat. (o) | 34.6478111 | Long. (o) | -77.1112083 | Alt. (m) | Depth (m) | Location on Map | |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F078166 | Metagenome | 116 | Y |
| Protein ID | Family | RBS | Sequence |
|---|---|---|---|
| Ga0209636_111048991 | F078166 | GAGG | MSTCENVLLHEENKGGYSLAIIAKFEEPFPVSYVIRVTTPQGVKVDYISTLEGFKNIGELLMALHYFAETKLYPKNTEKLREVLTADTIKNFAEVLESAKFSV |
| ⦗Top⦘ |