Scaffold Ga0209636_10130033

Overview

Basic Information

• Taxon OID: 3300027893
• Scaffold ID: Ga0209636_10130033
• Source Dataset Name: Marine sediment microbial communities from White Oak River estuary, North Carolina - WOR-1-52-54 (SPAdes)
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: DOE Joint Genome Institute (JGI)
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 2388
• Total Scaffold Genes: 5
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 5 (100.00%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 1 (100.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Archaea → TACK group → Candidatus Bathyarchaeota → unclassified Candidatus Bathyarchaeota → Candidatus Bathyarchaeota archaeon RBG_13_46_16b (Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Aquatic → Marine → Oceanic → Sediment → Marine Sediment → Marine Sediment Microbial Communities From White Oak River Estuary, North Carolina

Source Dataset Sampling Location

• Location Name: White Oak River estuary, North Carolina, USA
• Coordinates
  • Lat. (^o): 34.6478111
  • Long. (^o): -77.1112083

Associated Families

Family	Category	Number of Sequences	3D Structure?
F029929	Metagenome	187	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0209636_101300334	F029929	GAG	MVLLDLPIFQQSVNAELYLWLLKEQKTRKARSVQEVIRQVLREARKKAEHHG