Scaffold Ga0209628_10487524

Overview

Basic Information

• Taxon OID: 3300027891
• Scaffold ID: Ga0209628_10487524
• Source Dataset Name: Cubitermes ugandensis P4 segment gut microbial communities from Kakamega Forest, Kenya - Cu122 P4 (SPAdes)
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: DOE Joint Genome Institute (JGI)
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 1249
• Total Scaffold Genes: 4
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 1 (25.00%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 1 (100.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → malvids → Malvales → Malvaceae → Sterculioideae → Pterygota (Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem: Host-Associated → Arthropoda → Digestive System → Gut → Unclassified → Termite Gut → Cubitermes And Nasutitermes Termite Gut Microbial Communities From Max Planck Institute For Terrestrial Microbiology, Germany

Source Dataset Sampling Location

• Location Name: Kakamega Forest, Kenya
• Coordinates
  • Lat. (^o): 0.2917
  • Long. (^o): 34.856

Associated Families

Family	Category	Number of Sequences	3D Structure?
F097595	Metagenome	104	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0209628_104875243	F097595	AGAAGG	MHSLSISTVMWVDCLKTVIDYNSADECVTDSDEIMCDGHILRLINDNES